Products
Discover our full range of catalog products including Labeling and Detection, Peptides, Reagents for peptides synthesis, Assay Kits and Proteins.
921 - 940 of 1837
hBD-1, b-Defensin-1, human - 0.1 mg
- DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK (Disulfide bridge: 5-34, 12-27, 17-35)
- Cat.Number : AS-60740
HIV Substrate, HiLyte™ Fluor 488 - 0.1 mg
- QXL®520-GABA-SQNYPIVQ-K(HiLyte™ Fluor 488)-NH2
- Cat.Number : AS-60635
Thrombospondin (TSP-1) Inhibitor scrambled peptide, SLLK - 1 mg
- SLLK-NH2
- Cat.Number : AS-60875
Protease-Activated Receptor-4, PAR-4 Agonist 3, amide, murine - 1 mg
- GYPGKF-NH2
- Cat.Number : AS-60778
921 - 940 of 1837