Products

Discover our full range of catalog products including Labeling and Detection, Peptides, Reagents for peptides synthesis, Assay Kits and Proteins.

    81 - 100 of 1838

    PACAP (1-38), amide, human, ovine, rat, Biotin-labeled - 0.5 mg

    • Biotin-HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
    • Cat.Number : AS-23590
    Quick view

    Boc-O-methyl-L-tyrosine - 5 g

    • Cat.Number : AS-23176
    Quick view

    [Lys0]-Bradykinin (Kallidin) - 5 mg

    • KRPPGFSPFR
    • Cat.Number : AS-22853
    Quick view

    Fmoc-L-homophenylalanine - 5 g

    • Cat.Number : AS-23392
    Quick view

    AMC [7-Amino-4-methylcoumarin]

    • Cat.Number : AS-23482
    Quick view

    Fmoc-Gly-HMP-TentaGel resin - 1 g

    • Cat.Number : AS-23684
    Quick view

    Boc-Nalpha-methyl-O-benzyl-L-serine dicyclohexylammonium salt - 1 g

    • Cat.Number : AS-23143-B1
    Quick view

    VIP, human, porcine, rat

    • HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
    • Cat.Number : AS-22872
    Quick view

    Fmoc-Glu(EDANS)-OH - 1 g

    • Cat.Number : AS-23494
    Quick view

    PACAP (1-38)-Lys(Biotin), amide, human, ovine, rat - 0.5 mg

    • HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKK(Biotin)-NH2
    • Cat.Number : AS-23648
    Quick view

    Parathyroid Hormone (1-34)-Lys(Biotin), human - 1 mg

    • SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFK(Biotin)
    • Cat.Number : AS-23647
    Quick view

    S-Trityl-Mercaptoacetic acid

    • Cat.Number : AS-23559
    Quick view

    Fmoc-3-nitro-L-tyrosine - 1 g

    • Cat.Number : AS-23366
    Quick view

    Somatostatin 28, human, sheep, cow, rat, mouse, pig

    • SANSNPAMAPRERKAGCKNFFWKTFTSC (Disulfide bridge: 17-28)
    • Cat.Number : AS-22901
    Quick view

    Peptide YY (3-36), human

    • IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
    • Cat.Number : AS-24405
    Quick view

    [Lys8,9]-Neurotensin (8-13) - 5 mg

    • KKPYIL
    • Cat.Number : AS-24627
    Quick view

    Gastrin Releasing Peptide, human

    • VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2
    • Cat.Number : AS-24213
    Quick view

    Biotin-Oxytocin - 1 mg

    • Biotin-CYIQNCPLG-NH2 (Disulfide bridge: 1-6)
    • Cat.Number : AS-23994
    Quick view

    Cecropin A Peptide

    • KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2
    • Cat.Number : AS-24009
    Quick view

    Thrombin Receptor Activator for Peptide 6 (TRAP-6)

    • SFLLRN
    • Cat.Number : AS-24190
    Quick view
      81 - 100 of 1838