Products
Discover our full range of catalog products including Labeling and Detection, Peptides, Reagents for peptides synthesis, Assay Kits and Proteins.
1101 - 1120 of 1837
Beta-Amyloid Peptide (1-42), mouse, rat
- DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
- Cat.Number : AS-25381
SensoLyte® pNPP Secreted Alkaline Phosphatase Reporter Gene Assay Kit Colorimetric - 1 kit
- Cat.Number : AS-72144
SensoLyte® Plus 520 MMP-2 Assay Kit Fluorimetric and Enhanced Selectivity - 1 kit
- Cat.Number : AS-72224
SensoLyte® pNPP Alkaline Phosphatase Assay Kit Colorimetric - 1 kit
- Cat.Number : AS-72146
1101 - 1120 of 1837