Peptides

    1 - 5 of 5

    hBD-1, b-Defensin-1, human - 0.1 mg

    • DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK (Disulfide bridge: 5-34, 12-27, 17-35)

    hBD-3, b-Defensin-3, human - 0.1 mg

    • GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK (Disulfide bridge: 11-40, 18-33, 23-41)

    HNP-1, a-Defensin-1, Human Neutrophil Peptide-1 - 0.1 mg

    • ACYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide bridge: 2-30, 4-19, 9-29)

    HNP-2, a-Defensin-2, Human Neutrophil Peptide-2 - 0.1 mg

    • CYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide bridge: 1-29, 3-18, 8-28)
      1 - 5 of 5