Catalog

    1 - 5 of 5

    Calcitonin Gene Related Peptide, CGRP (alpha), human

    • ACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH2 (Disulfide bridge: 2-7)

    Calcitonin Gene Related Peptide, CGRP (alpha), human, Biotin-LC-labeled - 1 mg

    • Biotin-LC-ACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH2 (Disulfide bridge:2-7)

    Calcitonin Gene Related Peptide, CGRP (beta), human - 0.5 mg

    • ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH2 (Disulfide bridge:2-7)

    Calcitonin Gene Related Peptide,CGRP (alpha), aCGRP, rat, mouse - 1 mg

    • SCNTATCVTHRLAGLLSRSGGVVKDNFVPTNVGSEAF-NH2 (Disulfide bridge: 2-7)
      1 - 5 of 5