Catalog

    1 - 2 of 2

    Cecropin A Peptide

    • KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2

    Cecropin B - 0.5 mg

    • KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2
      1 - 2 of 2