Catalog

    1 - 20 of 27

    [Arg8]-Vasopressin (AVP) Peptide

    • CYFQNCPRG-NH2 (Disulfide bridge: 1-6)

    ACTH (1-24), human

    • SYSMEHFRWGKPVGKKRRPVKVYP

    ACTH (1-39), human

    • SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF

    ACTH (7-38), human - 1 mg

    • FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE

    Biotin-ACTH (1-39), human - 0.5 mg

    • Biotin-SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF

    Biotin-Oxytocin - 1 mg

    • Biotin-CYIQNCPLG-NH2 (Disulfide bridge: 1-6)

    Cetrorelix Acetate, Cetrotide - 1 mg

    • Ac-{d-A[3-(2-naphthyl)]}-[d-F(4-Cl)]-{d-A[3-(3-pyridyl)]}-SY-(d-Cit)-LRP-d-A-NH2•Acetate

    Corticotropin Releasing Factor, CRF, ovine - 0.5 mg

    • SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2

    Nesfatin-1 (24-53), human - 0.5 mg

    • PDTGLYYDEYLKQVIDVLETDKHFREKLQK-NH2
      1 - 20 of 27