Catalog

    1 - 20 of 45

    [Arg8]-Vasopressin (AVP) Peptide

    • CYFQNCPRG-NH2 (Disulfide bridge: 1-6)

    Adrenomedullin (1-50), rat - 0.5 mg

    • YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2 (Disulfide bridge: 14-19)

    Adrenomedullin (1-52), human - 0.5 mg

    • YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 (Disulfide bridge: 16-21)

    Apelin-36, human - 1 mg

    • LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF

    Atrial Natriuretic Peptide (1-28), human, porcine

    • SLRRSSCFGGRMDRIGAQSGLGCNSFRY (Disulfide bridge: 7-23)

    Atrial Natriuretic Peptide (1-28), rat

    • SLRRSSCFGGRIDRIGAQSGLGCNSFRY (Disulfide bridge: 7-23)

    Atrial Natriuretic Peptide (4-18), rat - 1 mg

    • RSSCFGGRIDRIGAC-NH2 (Disulfide bridge 4-15)

    Big Endothelin-1 (1-38), human - 0.5 mg

    • CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS (Disulfide bridge: 1-15 and 3-11)

    Big Endothelin-1 (1-39), porcine - 1 mg

    • CSCSSLMDKECVYFCHLDIIWVNTPEHIVPYGLGSPSRS (Disulfide bridge: 1-15 and 3-11)

    B-type Natriuretic Peptide, BNP-32, human

    • SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: 10-26)

    B-type Natriuretic Peptide, BNP-45 (51-95), rat - 0.5 mg

    • SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge:23-39)
      1 - 20 of 45