Products

Discover our full range of catalog products including Labeling and Detection, Peptides, Reagents for peptides synthesis, Assay Kits and Proteins.

    1 - 20 of 1860

    Beta-Amyloid (1-38) Peptide

    • DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG
    • Cat.Number : AS-24233

    Gastrin Releasing Peptide, human

    • VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2
    • Cat.Number : AS-24213

    Biotin-Oxytocin - 1 mg

    • Biotin-CYIQNCPLG-NH2 (Disulfide bridge: 1-6)
    • Cat.Number : AS-23994

    Cecropin A Peptide

    • KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2
    • Cat.Number : AS-24009

    ß-Endorphin, human - 1 mg

    • YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
    • Cat.Number : AS-24319

    Orexin A, bovine, human, mouse, rat - 1 mg

    • Pyr-PLPDCCRQKTCSCRLYELLHGAGNHAAGILTL-NH2 (Disulfide bridge: 6-12 and 7-14)
    • Cat.Number : AS-24470

    Biotin-ACTH (1-39), human - 0.5 mg

    • Biotin-SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
    • Cat.Number : AS-23968

    Atrial Natriuretic Peptide (1-28), human, porcine, Biotin-labeled - 0.5 mg

    • Biotin-SLRRSSCFGGRMDRIGAQSGLGCNSFRY (Disulfide bridge: 7-23)
    • Cat.Number : AS-23972

    Corticotropin Releasing Factor, CRF, human, rat - 1 mg

    • SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2
    • Cat.Number : AS-24254

    Oxytocin Peptide

    • CYIQNCPLG-NH2 (Disulfide bridge: 1-6)
    • Cat.Number : AS-24275

    HCV NS3 Protease Inhibitor 2 - 1 mg

    • Ac-DE-Dif-E-Cha-C
    • Cat.Number : AS-25346

    Beta-Amyloid (1-40) Peptide

    • DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
    • Cat.Number : AS-24235-
      1 - 20 of 1860