Blue (<500 nm)

Our portfolio includes 26 blue peptide enzyme substrates including fluorogenic substrates and FRET substrates.

    1 - 20 of 26

    HIV Protease FRET Substrate I - 1 mg

    • DABCYL-GABA-SQNYPIVQ-EDANS
    • Cat.Number : AS-22992

    Bacterial Sortase Substrate I, FRET - 1 mg

    • DABCYL-LPETG-EDANS
    • Cat.Number : AS-62231

    Cathepsin K substrate - 0.1 mg

    • Abz-HPGGPQ-EDDnp
    • Cat.Number : AS-62368

    Cathepsin D and E FRET Substrate - 1 mg

    • Mca-GKPILFFRLK(Dnp)-r-NH2
    • Cat.Number : AS-61793

    390 MMP FRET Substrate 5 - 1 mg

    • Mca-PLGLEEA-Dap(Dnp)-NH2
    • Cat.Number : AS-62027

    ADAMTS-13 FRET Substrate, FRETS-VWF73

    • DRE-Dap(Nma)-APNLVYMVTG-Dap(Dnp)-PASDEIKRLPGDIQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQR
    • Cat.Number : AS-63728-01

    Plasmepsin II FRET Substrate, Hemoglobin Fragment, 2837b - 1 mg

    • EDANS-CO-CH2-CH2-CO-ALERMFLSFP-Dap(DABCYL)OH
    • Cat.Number : AS-62050

    Cathepsin S Substrate - 1 mg

    • Ac-KQKLR-AMC
    • Cat.Number : AS-61859

    Renin FRET Substrate, R-E(EDANS)--K(Dabcyl) - 1 mg

    • R-E(EDANS)-IHPFHLVIHT-K(DABCYL)-R
    • Cat.Number : AS-62022

    ADAMTS-4/Aggrecanase FRET Substrate, WAAG-3R - 1 mg

    • Abz-TEGEARGSVI-Dap(Dnp)-KK-NH2
    • Cat.Number : AS-60431-1

    490 MMP FRET Substrate X - 1 mg

    • DABCYL-RPLALWRS-EDANS
    • Cat.Number : AS-27104

    390 MMP FRET Substrate 1 - 1 mg

    • Mca-PLGL-Dap(Dnp)-AR-NH2
    • Cat.Number : AS-27076
      1 - 20 of 26