Peptides

    1 - 20 of 20

    Biotin-TAT (47-57) - 1 mg

    • Biotin-YGRKKRRQRRR
    • Cat.Number : AS-61209

    Cys(Npys)-TAT (47-57) - 1 mg

    • C(Npys)YGRKKRRQRRR-NH2
    • Cat.Number : AS-61214

    Cys(Npys)-TAT (47-57), FAM-labeled - 1 mg

    • C(Npys)YGRKKRRQRRR-K(FAM)-NH2
    • Cat.Number : AS-61213

    Cys-TAT (47-57) - 1 mg

    • CYGRKKRRQRRR-NH2
    • Cat.Number : AS-61212

    FITC-LC-TAT (47-57

    • FITC-LC-YGRKKRRQRRR-NH2
    • Cat.Number : AS-27042

    HIV-1 Tat (48-60) - 1 mg

    • GRKKRRQRRRPPQ
    • Cat.Number : AS-63847

    TAT (47-57) GGG-Cys(Npys) - 1 mg

    • YGRKKRRQRRRGGG-C(Npys)-NH2
    • Cat.Number : AS-61215

    TAT (47-57) Peptide Fragment

    • YGRKKRRQRRR
    • Cat.Number : AS-60023-1

    TAT (47-57), FAM-labeled - 1 mg

    • FAM-YGRKKRRQRRR
    • Cat.Number : AS-61210

    TAT (47-57), TAMRA-labeled - 1 mg

    • TAMRA-YGRKKRRQRRR
    • Cat.Number : AS-61211

    TAT-GluR23A Fusion Peptide - 1 mg

    • YGRKKRRQRRRAKEGANVAG
    • Cat.Number : AS-64984

    TAT-HA2 Fusion Peptide - 1 mg

    • RRRQRRKKRGGDIMGEWGNEIFGAIAGFLG
    • Cat.Number : AS-64876

    TAT-NSF222 Fusion Peptide - 1 mg

    • YGRKKRRQRRR-GGG-LDKEFNSIFRRAFASRVFPPE
    • Cat.Number : AS-62240

    TAT-NSF222scr Fusion Polypeptide, scrambled - 1 mg

    • YGRKKRRQRRR-GGG-ENSFRFLADIFPAKAFPVRFE
    • Cat.Number : AS-62210

    TAT-NSF700 Fusion Peptide - 1 mg

    • YGRKKRRQRRR-GGG-LLDYVPIGPRFSNLVLQALLVL
    • Cat.Number : AS-62238

    TAT-NSF700scr - 1 mg

    • YGRKKRRQRRRGGGIPPVYFSRLDLNLVVLLLAQL
    • Cat.Number : AS-62209

    Tat-C (48-57) - 1 mg

    • CGRKKRRQRRR
    • Cat.Number : AS-62063

    Tat-GluR23Y - 1 mg

    • YGRKKRRQRRRYKEGYNVYG
    • Cat.Number : AS-64429

    Tat-GluR23Y, scrambled - 1 mg

    • YGRKKRRQRRRVYKYGGYNE
    • Cat.Number : AS-64428

    Tat-NR2Bct - 1 mg

    • YGRKKRRQRRRKLSSIESDV
    • Cat.Number : AS-62042
      1 - 20 of 20