Peptides

    1 - 20 of 50

    (Arg)9 - 1 mg

    • RRRRRRRRR
    • Cat.Number : AS-61204

    (Arg)9 biotin labeled - 1 mg

    • Biotin-LC-RRRRRRRRR-NH2
    • Cat.Number : AS-64078

    (Arg)9, FAM-labeled - 1 mg

    • FAM-RRRRRRRRR
    • Cat.Number : AS-61207

    (Arg)9, TAMRA-labeled - 1 mg

    • TAMRA-RRRRRRRRR
    • Cat.Number : AS-61208

    Aminopeptidase N Ligand (CD13), NGR peptide - 5 mg

    • CNGRCG (Disulfide bridge: 1-5)
    • Cat.Number : AS-60171-5

    Antennapedia Peptide, FAM-labeled - 1 mg

    • 5-FAM-RQIKIWFQNRRMKWKK-NH2
    • Cat.Number : AS-64212

    Antennapedia Peptide, acid - 1 mg

    • RQIKIWFQNRRMKWKK
    • Cat.Number : AS-61032

    Anti-BetaGamma (MPS-Phosducin-like protein C terminus)

    • AAVALLPAVLLALLAVTDQLGEDFFAVDLEAFLQEFGLLPEKE
    • Cat.Number : AS-24177

    Biotin-TAT (47-57) - 1 mg

    • Biotin-YGRKKRRQRRR
    • Cat.Number : AS-61209

    Buforin 2 - 1 mg

    • TRSSRAGLQFPVGRVHRLLRK
    • Cat.Number : AS-61255

    Cell Permeable-Mastoparan Peptide

    • INLKALAALAKKIL-NH2
    • Cat.Number : AS-24270

    Chimeric Rabies Virus Glycoprotein Fragment (RVG-9R) - 1 mg

    • YTIWMPENPRPGTPCDIFTNSRGKRASNGGGGRRRRRRRRR
    • Cat.Number : AS-62565

    Cys(Npys) Antennapedia Peptide, amide - 1 mg

    • C(Npys)-RQIKIWFQNRRMKWKK-NH2
    • Cat.Number : AS-61034

    Cys(Npys)-(Arg)9 - 1 mg

    • C(Npys)RRRRRRRRR-NH2
    • Cat.Number : AS-61205

    Cys(Npys)-(D-Arg)9 - 1 mg

    • C(Npys)RRRRRRRRR-NH2
    • Cat.Number : AS-61206

    Cys(Npys)-TAT (47-57) - 1 mg

    • C(Npys)YGRKKRRQRRR-NH2
    • Cat.Number : AS-61214

    Cys(Npys)-TAT (47-57), FAM-labeled - 1 mg

    • C(Npys)YGRKKRRQRRR-K(FAM)-NH2
    • Cat.Number : AS-61213

    Cys-TAT (47-57) - 1 mg

    • CYGRKKRRQRRR-NH2
    • Cat.Number : AS-61212

    FITC-LC-Antennapedia Peptide

    • FITC-LC-RQIKIWFQNRRMKWKK-NH2
    • Cat.Number : AS-24175

    FITC-LC-TAT (47-57

    • FITC-LC-YGRKKRRQRRR-NH2
    • Cat.Number : AS-27042
      1 - 20 of 50