Peptides

    1 - 20 of 32

    Beta-Amyloid (1-40) (S26C) - 1 mg

    • DAEFRHDSGYEVHHQKLVFFAEDVGCNKGAIIGLMVGGVV

    Beta-Amyloid (1-40) • HCl

    • DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV • HCl

    Beta-Amyloid (1-40) • HFIP

    • DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

    Beta-Amyloid (1-40) Peptide

    • DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

    Beta-Amyloid (1-40), FAM-labeled

    • FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

    Beta-Amyloid (1-40), HiLyte™ Fluor 488-labeled - 0.1 mg

    • HiLyte Fluor™ 488-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

    Beta-Amyloid (1-40), HiLyte™ Fluor 555-labeled - 0.1 mg

    • HiLyte Fluor™ 555-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

    Beta-Amyloid (1-40), HiLyte™ Fluor 647-labeled - 0.1 mg

    • HiLyte Fluor™ 647-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

    Beta-Amyloid (1-40), TAMRA-labeled - 0.1 mg

    • TAMRA-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

    Beta-Amyloid (1-40)-Cys - 0.1 mg

    • DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVC
      1 - 20 of 32