Peptides

Your selection

    1 - 20 of 32

    AggreSure ß-Amyloid (1-40), human - 0.25 mg

    • DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
    • Cat.Number : AS-72215

    Beta-Amyloid (1-40) (S26C) - 1 mg

    • DAEFRHDSGYEVHHQKLVFFAEDVGCNKGAIIGLMVGGVV
    • Cat.Number : AS-63671-1

    Beta-Amyloid (1-40) Peptide

    • DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
    • Cat.Number : AS-24235-

    Beta-Amyloid (1-40) • HCl

    • DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV • HCl
    • Cat.Number : AS-20698

    Beta-Amyloid (1-40) • HFIP

    • DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
    • Cat.Number : AS-64128-05

    Beta-Amyloid (1-40), FAM-labeled

    • FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
    • Cat.Number : AS-23514-01

    Beta-Amyloid (1-40), HiLyte™ Fluor 488-labeled - 0.1 mg

    • HiLyte Fluor™ 488-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
    • Cat.Number : AS-60491-01

    Beta-Amyloid (1-40), HiLyte™ Fluor 555-labeled - 0.1 mg

    • HiLyte Fluor™ 555-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
    • Cat.Number : AS-60492-01

    Beta-Amyloid (1-40), HiLyte™ Fluor 647-labeled - 0.1 mg

    • HiLyte Fluor™ 647-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
    • Cat.Number : AS-60493

    Beta-Amyloid (1-40), TAMRA-labeled - 0.1 mg

    • TAMRA-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
    • Cat.Number : AS-60488-01

    Beta-Amyloid (1-40)-Cys - 0.1 mg

    • DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVC
    • Cat.Number : AS-62233

    Beta-Amyloid (1-40)-Lys(Biotin)-NH2

    • DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-K(Biotin)-NH2
    • Cat.Number : AS-61483-01

    Beta-Amyloid (1-40)-Lys(Biotin)-NH2, mouse, rat - 0.1 mg

    • DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV-K(Biotin)-NH2
    • Cat.Number : AS-63356

    Beta-Amyloid (1-40)-Lys(Biotin-LC)

    • DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-K(Biotin-LC)
    • Cat.Number : AS-23517

    Beta-Amyloid (1-40)-Lys(LC-biotin)-NH2, FAM-labeled - 0.1 mg

    • 5-FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-K(LC-BIOTIN)-NH2
    • Cat.Number : AS-61962-01

    Beta-Amyloid (40-1)

    • VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
    • Cat.Number : AS-22817

    Beta-Amyloid Peptide (1-40), mouse, rat

    • DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV
    • Cat.Number : AS-25380-

    Biotin-LC-beta-Amyloid (1-40)

    • Biotin-LC-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
    • Cat.Number : AS-24648

    Biotin-beta-Amyloid (1-40)

    • Biotin-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
    • Cat.Number : AS-23512
      1 - 20 of 32