Peptides

    1 - 9 of 9

    LC-LL-37, 5-FAM labeled - 0.1 mg

    • 5-FAM-LC-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES

    LC-LL-37, biotinylated - 0.5 mg

    • Biotin-LC-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES

    LC-LL-37, with Cys in Nterm - 1 mg

    • C-LC-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES

    LL-37, reverse sequence - 0.5 mg

    • SETRPVLNRLFDKIRQVIRKFEKGIKEKSKRFFDGLL

    LL-37, scrambled - 1 mg

    • GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR
      1 - 9 of 9