Catalog

Your selection

    1 - 9 of 9

    LC-LL-37, 5-FAM labeled - 0.1 mg

    • 5-FAM-LC-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
    • Cat.Number : AS-63694

    LC-LL-37, biotinylated - 0.5 mg

    • Biotin-LC-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
    • Cat.Number : AS-63693

    LC-LL-37, with Cys in Nterm - 1 mg

    • C-LC-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
    • Cat.Number : AS-63692

    LL-37 fragment (17-29) - 5 mg

    • FKRIVQRIKDFLR
    • Cat.Number : AS-65454-5

    LL-37 fragment (17-32)

    • FKRIVQRIKDFLRNLV
    • Cat.Number : AS-65452-1

    LL-37 fragment (18-37) - 1 mg

    • KRIVQRIKDFLRNLVPRTES
    • Cat.Number : AS-63712

    LL-37, Antimicrobial Peptide, human - 1 mg

    • [LL-37, 37 aa]
    • Cat.Number : AS-61302

    LL-37, reverse sequence - 0.5 mg

    • SETRPVLNRLFDKIRQVIRKFEKGIKEKSKRFFDGLL
    • Cat.Number : AS-62208

    LL-37, scrambled - 1 mg

    • GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR
    • Cat.Number : AS-63708
      1 - 9 of 9