Products

Discover our full range of catalog products including Labeling and Detection, Peptides, Reagents for peptides synthesis, Assay Kits and Proteins.

Your selection

    1 - 20 of 181

    Aminopeptidase N Ligand (CD13), NGR peptide - 5 mg

    • CNGRCG (Disulfide bridge: 1-5)
    • Cat.Number : AS-60171-5

    490 MMP FRET Substrate X - 1 mg

    • DABCYL-RPLALWRS-EDANS
    • Cat.Number : AS-27104

    [Lys3]-Bombesin - 5 mg

    • Pyr-QKLGNQWAVGHLM-NH2
    • Cat.Number : AS-22838

    Gastrin Releasing Peptide, human

    • VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2
    • Cat.Number : AS-24213

    c-Myc peptide epitope

    • EQKLISEEDL
    • Cat.Number : AS-20590

    Bombesin - 1 mg

    • Pyr-QRLGNQWAVGHLM-NH2
    • Cat.Number : AS-20665

    MMP Colorimetric Substrate - 1 mg

    • Ac-PLG-SCH[CH2CH(CH3)2]-CO-LG-OC2H5
    • Cat.Number : AS-27096

    390 MMP FRET Substrate 1 - 1 mg

    • Mca-PLGL-Dap(Dnp)-AR-NH2
    • Cat.Number : AS-27076

    390 MMP FRET Substrate XI - 5 mg

    • Mca-P-Cha-G-Nva-HA-Dap(Dnp)-NH2
    • Cat.Number : AS-27109

    390 MMP Substrate XIII, NFF-3 - 1 mg

    • Mca-RPKPVE-Nva-WR-K(Dnp)-NH2
    • Cat.Number : AS-27114

    390 MMP FRET Substrate 2 - 5 mg

    • Mca-PLGL-Dap(Dnp)-AR
    • Cat.Number : AS-27079
      1 - 20 of 181