Products
Discover our full range of catalog products including Labeling and Detection, Peptides, Reagents for peptides synthesis, Assay Kits and Proteins.
1 - 20 of 271
SensoLyte® Anti-Mouse/Rat ß-Amyloid (1-42) Quantitative ELISA Kit Colorimetric - 1 kit
- Cat.Number : AS-55554
SensoLyte® Anti-Rat MOG (1-125) IgG Quantitative ELISA Kit Colorimetric - 1 kit
- Cat.Number : AS-55157
SensoLyte® Anti-Mouse/Rat ß-Amyloid (1-40) Quantitative ELISA Kit Colorimetric - 1 kit
- Cat.Number : AS-55553
SensoLyte® Anti-Human MOG (1-125) Human IgG Specific ELISA Kit Colorimetric - 1 kit
- Cat.Number : AS-55153-H
SensoLyte® Anti-Mouse MOG (1-125) IgG Quantitative ELISA Kit Colorimetric - 1 kit
- Cat.Number : AS-55156
Somatostatin 14, human, rat, mouse, pig, chicken, frog
- AGCKNFFWKTFTSC (Disulfide bridge: 3-14)
- Cat.Number : AS-24277
Ghrelin, rat, mouse Peptide
- GS-S(n-octanoyl)-FLSPEHQKAQQRKESKKPPAKLQPR
- Cat.Number : AS-24160
Beta-Amyloid (1-40), FAM-labeled
- FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
- Cat.Number : AS-23514-01
1 - 20 of 271