FRET Substrates

AnaSpec offers portfolio of nineteen blue FRET substrates. 390 MMP FRET Substrate 11 is an example. It is hydrolyzed by MMP-8, 9, 13, Abs/Em = 325/393 nm.

    1 - 19 of 19

    390 MMP FRET Substrate 1 - 1 mg

    • Mca-PLGL-Dap(Dnp)-AR-NH2
    • Cat.Number : AS-27076

    390 MMP FRET Substrate XI - 5 mg

    • Mca-P-Cha-G-Nva-HA-Dap(Dnp)-NH2
    • Cat.Number : AS-27109

    390 MMP FRET Substrate 2 - 5 mg

    • Mca-PLGL-Dap(Dnp)-AR
    • Cat.Number : AS-27079

    HIV Protease FRET Substrate I - 1 mg

    • DABCYL-GABA-SQNYPIVQ-EDANS
    • Cat.Number : AS-22992

    Bacterial Sortase Substrate I, FRET - 1 mg

    • DABCYL-LPETG-EDANS
    • Cat.Number : AS-62231

    Cathepsin K substrate - 0.1 mg

    • Abz-HPGGPQ-EDDnp
    • Cat.Number : AS-62368

    Plasmepsin V FRET Substrate - 1 mg

    • Dabcyl-LNKRLLHETQ-EDANS
    • Cat.Number : AS-64939

    ADAMTS-13 FRET Substrate, FRETS-VWF73

    • DRE-Dap(Nma)-APNLVYMVTG-Dap(Dnp)-PASDEIKRLPGDIQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQR
    • Cat.Number : AS-63728-01

    ADAMTS-4/Aggrecanase FRET Substrate, WAAG-3R - 1 mg

    • Abz-TEGEARGSVI-Dap(Dnp)-KK-NH2
    • Cat.Number : AS-60431-1

    490 MMP FRET Substrate X - 1 mg

    • DABCYL-RPLALWRS-EDANS
    • Cat.Number : AS-27104

    Cathepsin D and E FRET Substrate - 1 mg

    • Mca-GKPILFFRLK(Dnp)-r-NH2
    • Cat.Number : AS-61793

    390 MMP FRET Substrate 5 - 1 mg

    • Mca-PLGLEEA-Dap(Dnp)-NH2
    • Cat.Number : AS-62027

    Plasmepsin II FRET Substrate, Hemoglobin Fragment, 2837b - 1 mg

    • EDANS-CO-CH2-CH2-CO-ALERMFLSFP-Dap(DABCYL)OH
    • Cat.Number : AS-62050

    Renin FRET Substrate, R-E(EDANS)--K(Dabcyl) - 1 mg

    • R-E(EDANS)-IHPFHLVIHT-K(DABCYL)-R
    • Cat.Number : AS-62022
      1 - 19 of 19