
    1 - 8 of 8

    Amylin (1-37), Islet Amyloid Polypeptide, IAPP, human - 1 mg

    • Cat.Number : AS-60804

    Amylin (1-37), Islet Amyloid Polypeptide, IAPP, human, amide - 1 mg

    • Cat.Number : AS-60254-1

    Amylin (1-37), human, amide, Biotin-labeled - 0.5 mg

    • Cat.Number : AS-64451-05

    Amylin (1-37), rat, mouse

    • Cat.Number : AS-60253-05

    Amylin (20-29), human - 1 mg

    • Cat.Number : AS-60259-1

    Amylin (8-37), rat, mouse - 1 mg

    • Cat.Number : AS-21749

    Pramlintide, Acetate [Pro25, 28, 29]-Amylin(1-37), human, Amide - 1 mg

    • KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (Disulfide bridge), acetate salt
    • Cat.Number : AS-64576-1
      1 - 8 of 8