Peptides
AnaSpec manufactures many categories of peptides in Fremont, California, USA. Peptides represent over decades of innovative peptide synthesis expertise.
1 - 20 of 165
VIP, human, porcine, rat, FAM-labeled - 0.5 mg
- FAM-HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
- Cat.Number : AS-23614
[Thr28, Nle31]-Cholecystokinin (25-33), sulfated CCK-9 - 1 mg
- RD-Y(SO3H)-TGW-Nle-DF-NH2
- Cat.Number : AS-22944
Somatostatin 14, human, rat, mouse, pig, chicken, frog
- AGCKNFFWKTFTSC (Disulfide bridge: 3-14)
- Cat.Number : AS-24277
Ghrelin, rat, mouse Peptide
- GS-S(n-octanoyl)-FLSPEHQKAQQRKESKKPPAKLQPR
- Cat.Number : AS-24160
[Leu31, Pro34]-Neuropeptide Y, human, rat - 1 mg
- YPSKPDNPGEDAPAEDMARYYSALRHYINLLTRPRY-NH2
- Cat.Number : AS-24366
Endothelin 3, human, rat, mouse, rabbit
- CTCFTYKDKECVYYCHLDIIW (Disulfide bridge: 1-15 and 3-11)
- Cat.Number : AS-24323
[Arg8]-Vasopressin (AVP) Peptide
- CYFQNCPRG-NH2 (Disulfide bridge: 1-6)
- Cat.Number : AS-24289
Bradykinin Antagonist, HOE I40 - 1 mg
- rRP-(Hyp)-G-(Thi)-S-(D-Tic)-(Oic)-R
- Cat.Number : AS-22968
Corticotropin Releasing Factor, CRF, ovine - 0.5 mg
- SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2
- Cat.Number : AS-22932
[Succinyl-Asp6, NMePhe8]-Substance P (6-11), Senktide - 5 mg
- Suc-DF-(NMeF)-GLM-NH2
- Cat.Number : AS-22887
Calcitonin Gene Related Peptide, CGRP (alpha) (8-37), human - 1 mg
- VTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH2
- Cat.Number : AS-22857
Endothelin 1, human, porcine, bovine, mouse, rat
- CSCSSLMDKECVYFCHLDIIW (Disulfide bridge: 1-15 and 3-11)
- Cat.Number : AS-22859
Glucagon-Like Peptide 1 GLP-1 (7-36) amide human mouse rat bovine guinea pig Biotin-labeled - 0.5 mg
- Biotin-HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
- Cat.Number : AS-23586
1 - 20 of 165