Peptides  >  GPCR Peptide Ligands  >  Neuropeptide
 Product Size Catalog # US$  
[Leu31, Pro34] - Neuropeptide Y, human, rat
YPSKPDNPGEDAPAEDMARYYSALRHYINLLTRPRY - NH2
1 mg AS-24366 $181
Neuropeptide Y, human, rat
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY - NH2
0.5 mg AS-22464 $121
Neuropeptide Y, human, rat
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY - NH2
1 mg AS-22465 $181
  < Back