Peptides  >  Cell Permeable Peptides (CPP) / Drug Delivery Peptides
Efficient transfer of proteins or nucleic acids across cellular membranes is one of the major problems in cell biology. To deliver the functional domain of a selected protein from the outside to the inside of intact cells, a carrier is needed. Cell Permeable Peptides, also known as Protein Transduction Domains (PTDs), are carriers with small peptide domains that can freely cross cell membranes. Several PTDs have been identified that allow a fused protein to efficiently cross cell membranes in a process known as protein transduction. Studies have demonstrated that a TAT peptide derived from the HIV TAT protein has the ability to transduce peptides or proteins into various cells. PTDs have been utilized in anticancer strategy, for example, a cell permeable Bcl-2 binding peptide, cpm1285, shows activity in slowing human myeloid leukemia growth in mice. Cell-permeable phosphopeptides, such as FGFR730pY, which mimics receptor binding sites for specific SH2 domain-containing proteins are potential tools for cancer research and cell signaling mechanism studies.

Time-lapse video of FITC-LC-Antennapedia peptide (cat# 24175, 24176)
entry into a neuronal cluster of cells. Video courtesy of Dr. E. Gruenstein,
Univ. of Cincinnati Medical School, Cincinnati, OH.

Figure 1. Uptake of CPP by HeLa cells. HeLa cells were incubated with OptiMEM
medium containing 10 uM FITC-LC-Antennapedia, cat# 24175, 24176 (panel A) and
10 uM of TAMRA-labelled TAT (47-57), cat# 61211(B) for 1 h, washed and analyzed
by fluorescence microscopy.
Ref: Embury, J. et al. Diabetes 50, 1706 (2001), Wang, H. et al. J. Clin. Invest. 109, 1463 (2002); Lin, Y-Z. J. Biol. Chem. 270, 14255 (1995); Holzberg, D. et al. J. Biol. Chem. 278, 40213 (2003); Williams, E. et al. J. Biol. Chem. 272, 22349 (1997); Nakatani, KH. et al. Nat. Med. 10, 1128 (2004); Mortlock, A. et al. Nucleic Acids Res. 31, e152 (2003); Kaneto, H. et al. Nat. Med. 10, 1128 (2004); Wang, JL. et al. Cancer Res. 60, 1498 (2000); Oess S. and E. Hildt, Gene. Ther. 7, 750 (2000); Dunican, D. et al. Cell Growth Diff. 12, 255 (2001).
 Product Size Catalog # US$  
(Arg)9
RRRRRRRRR
RRRRRRRRR
1 mg 61204 $61
(Arg)9 biotin labeled
Biotin - LC - RRRRRRRRR - NH2
Biotin - LC - RRRRRRRRR - NH2
1 mg 64078 $105
(Arg)9, FAM - labeled
FAM - RRRRRRRRR
FAM - RRRRRRRRR
1 mg 61207 $242
(Arg)9, TAMRA - labeled
TAMRA - RRRRRRRRR
TAMRA - RRRRRRRRR
1 mg 61208 $264
[Cys58]105Y, Cell Penetrating Peptide, α1 - antitrypsin (358 - 374)
CSIPPEVKFNKPFVYLI
CSIPPEVKFNKPFVYLI
1 mg 62005 $105
Aminopeptidase N Ligand (CD13), NGR peptide
CNGRCG (Disulfide bridge: 1 - 5)
CNGRCG (Disulfide bridge: 1 - 5)
1 mg 60171-1 $121
Aminopeptidase N Ligand (CD13), NGR peptide
CNGRCG (Disulfide bridge: 1 - 5)
CNGRCG (Disulfide bridge: 1 - 5)
5 mg 60171-5 $484
Antennapedia Leader Peptide (CT)
KKWKMRRNQFWVKVQRG
KKWKMRRNQFWVKVQRG
1 mg 61376 $105
Antennapedia Peptide, acid
RQIKIWFQNRRMKWKK
RQIKIWFQNRRMKWKK
1 mg 61032 $99
Antennapedia Peptide, amide
RQIKIWFQNRRMKWKK - NH2
RQIKIWFQNRRMKWKK - NH2
1 mg 61033 $99
Antennapedia Peptide, FAM - labeled
5 - FAM - RQIKIWFQNRRMKWKK - NH2
5 - FAM - RQIKIWFQNRRMKWKK - NH2
1 mg 64212 $242
Anti - BetaGamma (MPS - Phosducin - like protein C terminus)
AAVALLPAVLLALLAVTDQLGEDFFAVDLEAFLQEFGLLPEKE
AAVALLPAVLLALLAVTDQLGEDFFAVDLEAFLQEFGLLPEKE
0.5 mg 24177 $242
Anti - BetaGamma (MPS - Phosducin - like protein C terminus)
AAVALLPAVLLALLAVTDQLGEDFFAVDLEAFLQEFGLLPEKE
AAVALLPAVLLALLAVTDQLGEDFFAVDLEAFLQEFGLLPEKE
1 mg 24178 $435
Bcl - 2 Binding Peptide, cell permeable
Decanoyl - KNLWAAQRYGRELRRMSDEFEGSFKGL
Decanoyl - KNLWAAQRYGRELRRMSDEFEGSFKGL
1 mg 64127 $215
Beclin - 1  NEW
TNVFNATFHIWHSGQFGT
TNVFNATFHIWHSGQFGT
1 mg 65466 $110
Biotin - TAT (47 - 57)
Biotin - YGRKKRRQRRR
Biotin - YGRKKRRQRRR
1 mg 61209 $115
Buforin
TRSSRAGLQFPVGRVHRLLRK
TRSSRAGLQFPVGRVHRLLRK
1 mg 61255 $176
Chimeric Rabies Virus Glycoprotein Fragment (RVG - 9R)
YTIWMPENPRPGTPCDIFTNSRGKRASNGGGGRRRRRRRRR
YTIWMPENPRPGTPCDIFTNSRGKRASNGGGGRRRRRRRRR
1 mg 62565 $484
Cys(Npys) Antennapedia Peptide, amide
C(Npys) - RQIKIWFQNRRMKWKK - NH2
C(Npys) - RQIKIWFQNRRMKWKK - NH2
1 mg 61034 $143
Cys(Npys) - (Arg)9
C(Npys)RRRRRRRRR - NH2
C(Npys)RRRRRRRRR - NH2
1 mg 61205 $242
Cys(Npys) - (D - Arg)9
C(Npys)rrrrrrrrr - NH2
C(Npys)rrrrrrrrr - NH2
1 mg 61206 $291
Cys(Npys) - TAT (47 - 57)
C(Npys)YGRKKRRQRRR - NH2
C(Npys)YGRKKRRQRRR - NH2
1 mg 61214 $242
Cys(Npys) - TAT (47 - 57), FAM - labeled
C(Npys)YGRKKRRQRRR - K(FAM) - NH2
C(Npys)YGRKKRRQRRR - K(FAM) - NH2
1 mg 61213 $291
Cys - TAT (47 - 57)
CYGRKKRRQRRR - NH2
CYGRKKRRQRRR - NH2
1 mg 61212 $99
FITC - LC - Antennapedia Peptide
FITC - LC - RQIKIWFQNRRMKWKK - NH2
FITC - LC - RQIKIWFQNRRMKWKK - NH2
0.5 mg 24175 $154
FITC - LC - Antennapedia Peptide
FITC - LC - RQIKIWFQNRRMKWKK - NH2
FITC - LC - RQIKIWFQNRRMKWKK - NH2
1 mg 24176 $242
FITC - LC - MTS
FITC - LC - AAVLLPVLLAAP - NH2
FITC - LC - AAVLLPVLLAAP - NH2
0.5 mg 24188 $242
FITC - LC - MTS
FITC - LC - AAVLLPVLLAAP - NH2
FITC - LC - AAVLLPVLLAAP - NH2
1 mg 29851 $435
FITC - LC - TAT (47 - 57)
FITC - LC - YGRKKRRQRRR - NH2
FITC - LC - YGRKKRRQRRR - NH2
0.5 mg 27042 $154
FITC - LC - TAT (47 - 57)
FITC - LC - YGRKKRRQRRR - NH2
FITC - LC - YGRKKRRQRRR - NH2
1 mg 27043 $242
hCT (Calcitonin), Human  NEW
LGTYTQDFNKFHTFPQTAIGVGAP
LGTYTQDFNKFHTFPQTAIGVGAP
1 mg 65458 $110
Hel 13 - 5
KLLKLLLKLWLKLLKLLL
KLLKLLLKLWLKLLKLLL
1 mg 63894 $121
HIV - 1 Tat (48 - 60)
GRKKRRQRRRPPQ
GRKKRRQRRRPPQ
1 mg 63847 $83
KALA  NEW
WEAKLAKALAKALAKHLAKALAKALKACEA
WEAKLAKALAKALAKHLAKALAKALKACEA
1 mg 65459 $195
MAP (KLAL)  NEW
KLALKLALKALKAALKLA
KLALKLALKALKAALKLA
1 mg 65460 $110
Mastoparan
INLKALAALAKKIL - NH2
INLKALAALAKKIL - NH2
1 mg 24270 $49
Mastoparan
INLKALAALAKKIL - NH2
INLKALAALAKKIL - NH2
5 mg 24269 $193
Mastoparan 7
INLKALAALAKALL - NH2
INLKALAALAKALL - NH2
1 mg 62646 $93
Mastoparan X
INWKGIAAMAKKLL - NH2
INWKGIAAMAKKLL - NH2
1 mg 62647 $93
Maurocalcine  NEW
GDC(acm)LPHLKLC
GDC(acm)LPHLKLC
1 mg 65461 $110
MEK1 Derived Peptide Inhibitor 1
MPKKKPTPIQLNP
MPKKKPTPIQLNP
5 mg 60185-5 $313
Membrane - Permeable Sequence, MPS
AAVALLPAVLLALLAK
AAVALLPAVLLALLAK
1 mg 61218 $99
MPGΔNLS, HIV related;
GALFLGFLGAAGSTMGAWSQPKSKRKV
GALFLGFLGAAGSTMGAWSQPKSKRKV
1 mg 60633 $363
MPS - Gαi3
AAVALLPAVLLALLAKNNLKECGLY
AAVALLPAVLLALLAKNNLKECGLY
1 mg 61217 $198
NGR Peptide 1
CNGRCGGklaklakklaklak - NH2 (Disulfide bridge: 1 - 5)
CNGRCGGklaklakklaklak - NH2 (Disulfide bridge: 1 - 5)
1 mg 60189-1 $237
NGR Peptide 2
CNGRCGGLVTT (Disulfide bridge: 1 - 5)
CNGRCGGLVTT (Disulfide bridge: 1 - 5)
1 mg 60190-1 $115
NGR Peptide 3
CNGRC - NH2 (Disulfide bridge: 1 - 5)
CNGRC - NH2 (Disulfide bridge: 1 - 5)
1 mg 60191-1 $121
NGR Peptide 3
CNGRC - NH2 (Disulfide bridge: 1 - 5)
CNGRC - NH2 (Disulfide bridge: 1 - 5)
5 mg 60191-5 $484
NRTN (Neurturin), Human  NEW
GAAEAAARVYDLGLRRLRQRRRLRRERVRA
GAAEAAARVYDLGLRRLRQRRRLRRERVRA
1 mg 65462 $195
Nuclear Localiation Signal Peptide
PKKKRKV
PKKKRKV
1 mg 61257 $71
P1, Human  NEW
MGLGLHLLVLAAALQGAWSQPKKKRKV
MGLGLHLLVLAAALQGAWSQPKKKRKV
1 mg 65463 $195
P22 N (14 - 30)
NAKTRRHERRRKLAIER
NAKTRRHERRRKLAIER
1 mg 64204 $105
Penetratin
RQIKIWFQNRRMKWKKGG
RQIKIWFQNRRMKWKKGG
1 mg 64885 $99
Penetratin - Arg  NEW
RQIRIWFQNRRMRWRR
RQIRIWFQNRRMRWRR
1 mg 65464 $110
Pep - 1 - Cysteamine
Ac - KETWWETWWTEWSQPKKKRKV - cysteamine
Ac - KETWWETWWTEWSQPKKKRKV - cysteamine
1 mg 63849 $193
Pep - 1: Chariot (Non - Covalent Delivery of Peptides and Proteins)
KETWWETWWTEWSQPKKKRKV
KETWWETWWTEWSQPKKKRKV
1 mg 61253 $176
pVEC (Cadherin - 5)  NEW
LLIILRRRIRKQAHAHSK
LLIILRRRIRKQAHAHSK
1 mg 65465 $110
Rabies Virus Glycoprotein (RVG)
YTIWMPENPRPGTPCDIFTNSRGKRASNG
YTIWMPENPRPGTPCDIFTNSRGKRASNG
1 mg 62566 $225
SV - 40 Large T - antigen Nuclear Localization Signal (NLS)
CGGGPKKKRKVED
CGGGPKKKRKVED
1 mg 63831 $77
SV40 T - Ag - derived Nuclear Localization Signal (NLS) Peptide
PKKKRKVEDPYC
PKKKRKVEDPYC
1 mg 63788 $83
SynB1
RGGRLSYSRRRFSTSTGRA
RGGRLSYSRRRFSTSTGRA
1 mg 61254 $115
TAT (47 - 57)
YGRKKRRQRRR
YGRKKRRQRRR
1 mg 60023-1 $93
TAT (47 - 57)
YGRKKRRQRRR
YGRKKRRQRRR
5 mg 60023-5 $363
TAT (47 - 57) GGG - Cys(Npys)
YGRKKRRQRRRGGG - C(Npys) - NH2
YGRKKRRQRRRGGG - C(Npys) - NH2
1 mg 61215 $242
TAT (47 - 57), FAM - labeled
FAM - YGRKKRRQRRR
FAM - YGRKKRRQRRR
1 mg 61210 $203
TAT (47 - 57), TAMRA - labeled
TAMRA - YGRKKRRQRRR
TAMRA - YGRKKRRQRRR
1 mg 61211 $231
Tat (48 - 57)
GRKKRRQRRR
GRKKRRQRRR
1 mg 62064 $61
Tat - Beclin - 1  NEW
YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT
YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT
1 mg 65467 $195
Tat - Beclin - 1, scrambled  NEW
YGRKKRRQRRRGGVGNDFFINHETTGFATEW
YGRKKRRQRRRGGVGNDFFINHETTGFATEW
1 mg 65468 $195
Tat - C (48 - 57)
CGRKKRRQRRR
CGRKKRRQRRR
1 mg 62063 $66
TAT - GluR23A Fusion Peptide
YGRKKRRQRRRAKEGANVAG
YGRKKRRQRRRAKEGANVAG
1 mg 64984 $110
Tat - GluR23Y
YGRKKRRQRRRYKEGYNVYG
YGRKKRRQRRRYKEGYNVYG
1 mg 64429 $110
Tat - GluR23Y, scrambled
YGRKKRRQRRRVYKYGGYNE
YGRKKRRQRRRVYKYGGYNE
1 mg 64428 $110
TAT - HA2 Fusion Peptide
RRRQRRKKRGGDIMGEWGNEIFGAIAGFLG
RRRQRRKKRGGDIMGEWGNEIFGAIAGFLG
1 mg 64876 $215
Tat - NR2Bct
YGRKKRRQRRRKLSSIESDV
YGRKKRRQRRRKLSSIESDV
1 mg 62042 $237
TAT - NSF222 Fusion Peptide
YGRKKRRQRRR - GGG - LDKEFNSIFRRAFASRVFPPE
YGRKKRRQRRR - GGG - LDKEFNSIFRRAFASRVFPPE
1 mg 62240 $313
TAT - NSF222scr Fusion Polypeptide, scrambled
YGRKKRRQRRR - GGG - ENSFRFLADIFPAKAFPVRFE
YGRKKRRQRRR - GGG - ENSFRFLADIFPAKAFPVRFE
1 mg 62210 $308
TAT - NSF700 Fusion Peptide
YGRKKRRQRRR - GGG - LLDYVPIGPRFSNLVLQALLVL
YGRKKRRQRRR - GGG - LLDYVPIGPRFSNLVLQALLVL
1 mg 62238 $325
TAT - NSF700scr
YGRKKRRQRRRGGGIPPVYFSRLDLNLVVLLLAQL
YGRKKRRQRRRGGGIPPVYFSRLDLNLVVLLLAQL
1 mg 62209 $308
TAT - NSF81scr Fusion Polypeptide , scrambled
YGRKKRRQRRR - GGG - QDGCKYFATDETIMKLSIAI
YGRKKRRQRRR - GGG - QDGCKYFATDETIMKLSIAI
1 mg 62215 $269
TfR Targeting Peptide
THRPPMWSPVWP
THRPPMWSPVWP
1 mg 64689 $66
Transdermal Peptide
ACSSSPSKHCG
ACSSSPSKHCG
1 mg 62066 $61
Transportan
GWTLNSAGYLLGKINLKALAALAKKIL
GWTLNSAGYLLGKINLKALAALAKKIL
1 mg 61256 $237
  < Back