Peptides  >  Amyloid Peptides  >  Beta-Amyloid Peptide Fragments
 Product Size Catalog # US$  
Beta - Amyloid (1 - 9), Human
DAEFRHDSG
1 mg AS-61970 $71
Beta - Amyloid (1 - 10), Human
DAEFRHDSGY
1 mg AS-64478 $61
Beta - Amyloid (1 - 11), Human
DAEFRHDSGYE
1 mg AS-22819 $71
Beta - Amyloid (1 - 12), Human
DAEFRHDSGYEV
1 mg AS-62967 $83
Beta - Amyloid (1 - 13), Human
DAEFRHDSGYEVH
1 mg AS-64480 $83
Beta - Amyloid (1 - 15), Human
DAEFRHDSGYEVHHQ
1 mg AS-61798 $93
Beta - Amyloid (1 - 15) - Lys16(HiLyte™ Fluor 488), Human 0.5 mg AS-62002-05 $237
Beta - Amyloid (1 - 16), Human
DAEFRHDSGYEVHHQK
1 mg AS-24225 $83
Beta - Amyloid (1 - 16), Human
DAEFRHDSGYEVHHQK
5 mg AS-24226 $341
Beta - Amyloid (1 - 16) - Lys(Biotin - LC) - NH2, Human
DAEFRHDSGYEVHHQK - K(Biotin - LC) - NH2
1 mg AS-62136 $181
Beta - Amyloid (1 - 17), Human
DAEFRHDSGYEVHHQKL
1 mg AS-61955 $110
Beta - Amyloid (1 - 17) - Cys, Human
DAEFRHDSGYEVHHQKLC
1 mg AS-62473 $121
Beta - Amyloid (1 - 22), Human
DAEFRHDSGYEVHHQKLVFFAE
1 mg AS-62966 $181
Beta - Amyloid (1 - 33), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIG
1 mg AS-60250-1 $413
Beta - Amyloid (1 - 34), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL
0.5 mg AS-61799 $176
Beta - Amyloid (1 - 36), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMV
0.5 mg AS-60252-05 $264
Beta - Amyloid (1 - 37), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG
0.5 mg AS-60251-05 $264
Beta - Amyloid (1 - 37), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG
1 mg AS-60251-1 $423
Beta - Amyloid (1 - 38), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG
0.5 mg AS-24233 $154
Beta - Amyloid (1 - 38), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG
1 mg AS-24234 $275
ClearPoint™ beta - Amyloid (1 - 38), 13C - Phe & Ile, Human
DAEFRHDSGYEVHHQKLV - *F - *F - AEDVGSNKGA - *I - *I - GLMVGG *F=Phe(U - 13C9), *I=Ile(U - 13C6)
0.05 mg AS-65220 $117
Beta - Amyloid (1 - 39), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV
0.5 mg AS-24295 $181
Beta - Amyloid (1 - 39), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV
1 mg AS-24296 $335
Beta - Amyloid (3 - 16), Human
EFRHDSGYEVHHQK
1 mg AS-64793 $77
Beta - Amyloid (10 - 20), Human
YEVHHQKLVFF
1 mg AS-25365 $61
Beta - Amyloid (10 - 26), Human
YEVHHQKLVFFAEDVGS
1 mg AS-62885 $105
Beta - Amyloid (10 - 35) - Lys(Biotin) - NH2, Human
YEVHHQKLVFFAEDVGSNKGAIIGLM - K(Biotin) - NH2
0.1 mg AS-63745 $121
Beta - Amyloid (11 - 17), Human
EVHHQKL
1 mg AS-63819 $71
Beta - Amyloid (11 - 22), Human
EVHHQKLVFFAE
1 mg AS-23956 $99
Beta - Amyloid (11 - 25), Human
EVHHQKLVFFAEDVG
1 mg AS-62884 $93
Biotin - LC - beta - Amyloid (15 - 25), Human, mouse/rat
Biotin - LC - QKLVFFAEDVG
1 mg AS-62907 $115
Beta - Amyloid (16 - 22), Human, mouse/rat
KLVFFAE
1 mg AS-62897 $71
Beta - Amyloid (17 - 24), Human, mouse/rat
LVFFAEDV
1 mg AS-61978 $71
Beta - Amyloid (22 - 35), Human, mouse/rat
EDVGSNKGAIIGLM
1 mg AS-22823 $115
Biotin - LC - beta - Amyloid (22 - 41), Human, mouse/rat
Biotin - LC - EDVGSNKGAIIGLMVGGVVI
1 mg AS-62455 $198
Beta - Amyloid (25 - 35), Human, mouse/rat
GSNKGAIIGLM
1 mg AS-24227 $49
Beta - Amyloid (25 - 35), Human, mouse/rat
GSNKGAIIGLM
5 mg AS-24228 $193
Beta - Amyloid (25 - 35) • HCl, Human, mouse/rat
GSNKGAIIGLM • HCl
5 mg AS-23212 $313
Beta - Amyloid (25 - 35), scrambled, Human, mouse/rat
MAKGINGISGL
1 mg AS-61971 $71
Beta - Amyloid (25 - 35), HiLyte™ Fluor 488 - labeled, Human, mouse/rat
HiLyte™ Fluor 488 - GSNKGAIIGLM
0.1 mg AS-63308 $110
Biotin - beta - Amyloid (25 - 35), Human, mouse/rat
Biotin - GSNKGAIIGLM
1 mg AS-62451 $105
Beta - Amyloid (40 - 1), Human
VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
0.5 mg AS-22817 $193
Beta - Amyloid (40 - 1), Human
VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
1 mg AS-22818 $325
  < Back