Peptides  >  Antimicrobial and Related Peptides
Cationic antimicrobial peptides are important components of the innate defenses of all species. More than 100 of these peptides have been identified in numerous organisms, including fungi, insects, amphibians and humans. These hydrophobic and amphipathic peptides exhibit antibiotic, fungicidal, hemolytic, virucidal, and tumoricidal activities. Based on their structural properties, these antimicrobial peptides can be grouped into three classes, peptides that are helicoidal, peptides containing one to several disulfide bridges and peptides rich in certain amino acids such as proline or tryptophan. Most of these peptides share some common characteristics, such as their low molecular mass (2–5 kDa), the presence of multiple lysine and arginine residues and an amphipathic nature. Although the exact mechanism by which they kill bacteria is not clearly understood, it has been shown that peptide–lipid interactions leading to membrane permeation play a role in their activity. Examples of antibiotic peptides include magainins, secreted by the skin of Xenopus laevis; defensins from the human neutrophils and histatins from human saliva. Cecropins are produced by insects under conditions of infections. Cecropins A, B, and D are close homologues consisting of 35-39 residues found in the pupae of the cecropin moth.
Ref: Won, H. et al. Eur. J. Biochem. 269, 4367 (2002); Hancock, REW. and MG. Scott, Proc. Natl. Acad. Sci. USA 97, 8856 (2000); Andreu, D. et al. Proc. Natl. Acad. Sci. USA 80, 6475 (1983); M. Vaara and T. Vaara, Antimicrob. Agents Chemo. 38, 2498 (1994); Vizioli J. et al. Insect. Mol. Biol. 9, 75 (2000); Silvestro, L. et al. Antimicrob. Agents Chemo. 44, 602 (2000); Helmerhorst, E. et al. J. Biol. Chem. 274, 7286 (1999).
 Product Size Catalog # US$  
5 - FAM - LC - LL - 37
5 - FAM - LC - [LL-37, 37 aa]
0.1 mg AS-63694 $132
Apidaecin IB
GNNRPVYIPQPRPPHPRL
1 mg AS-62044 $110
Bac2A; Bactenecin 2A
RLARIVVIRVAR - NH2
1 mg AS-64906 $71
Biotin - LC - LL - 37
Biotin - LC - [LL-37, 37 aa]
0.5 mg AS-63693 $291
CAP - 18, rabbit
GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY
0.5 mg AS-61307 $231
Cecropin A
KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK - NH2
0.5 mg AS-24009 $176
Cecropin A
KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK - NH2
1 mg AS-24010 $291
Cecropin B
KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL - NH2
0.5 mg AS-24011 $176
CSP - 2, Competence - Stimulating Peptide - 2
EMRISRIILDFLFLRKK
1 mg AS-63877 $105
Cys - LC - LL - 37
C - LC - [LL-37, 37 aa]
1 mg AS-63692 $291
Dermcidin, DCD - 1L
SSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL
0.1 mg AS-63713 $143
Drosocin
GKPRPYSPRPTSHPRPIRV
1 mg AS-62600 $115
Elafin
AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ (Disufide bonds between Cys16 - Cys45, Cys23 - Cys49, Cys32 - Cys44, Cys38 - Cys53)
0.1 mg AS-61641 $237
HEL (46 - 61)
NTDGSTDYGILQINSR
1 mg AS-60504-1 $143
Histatin - 5
DSHAKRHHGYKRKFHEKHHSHRGY
1 mg AS-61001 $193
Human Lactotransferrin (37 - 61), Lactoferricin H
TKCFQWQRNMRKVR - G - PPVSCIKRDS (Disulfide between Cys3 and Cys20)
1 mg AS-64074 $231
Human Platelet Factor IV 18, C18G
ALYKKLLKKLLKSAKKLG
1 mg AS-62412 $110
Indolicidin
ILPWKWPWWPWRR - NH2
1 mg AS-60999 $143
Lactoferricin B, Lactoferrin (17 - 41)
FKCRRWQWRMKKLGAPSITCVRRAF (S - S BOND)
1 mg AS-62651 $198
LEAP - 1, Hepcidin, human
DTHFPICIFCCGCCHRSKCGMCCKT (Disulfide bridges: 7 - 23, 10 - 13, 11 - 19, 14 - 22)
0.1 mg AS-61432 $215
LL - 37 fragment (18 - 37), LL - 18 - 37
KRIVQRIKDFLRNLVPRTES
1 mg AS-63712 $121
LL - 37, Antimicrobial Peptide, human
[LL-37, 37 aa]
1 mg AS-61302 $179
LL - 37, reverse sequence
SETRPVLNRLFDKIRQVIRKFEKGIKEKSKRFFDGLL
0.5 mg AS-62208 $143
LL - 37, scrambled
GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR
1 mg AS-63708 $303
LL17 - 29
FKRIVQRIKDFLR
5 mg AS-65454-5 $150
LL17 - 32
FKRIVQRIKDFLRNLV
1 mg AS-65452-1 $70
LL17 - 32
FKRIVQRIKDFLRNLV
5 mg AS-65452-5 $150
Magainin 1
GIGKFLHSAGKFGKAFVGEIMKS
0.5 mg AS-20791 $99
Magainin 1
GIGKFLHSAGKFGKAFVGEIMKS
1 mg AS-20792 $143
Magainin 2
GIGKFLHSAKKFGKAFVGEIMNS
0.5 mg AS-20639 $99
Magainin 2
GIGKFLHSAKKFGKAFVGEIMNS
1 mg AS-20640 $143
mCRAMP, mouse
GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ
1 mg AS-61305 $275
Melittin, honey bee
GIGAVLKVLTTGLPALISWIKRKRQQ - NH2
1 mg AS-62366 $181
Protegrine - 1 (PG - 1), amide
RGGRLCYCRRRFCVCVGR - NH2 (disulfide bridge:6 - 15 and 8 - 13)
1 mg AS-64819-1 $550
Protegrine - 1 (PG - 1), amide
RGGRLCYCRRRFCVCVGR - NH2 (disulfide bridge:6 - 15 and 8 - 13)
0.5 mg AS-64819-05 $313
Pyrrhocoricin
VDKGSYLPRPTPPRPIYNRN
1 mg AS-62601 $121
rCRAMP
GLVRKGGEKFGEKLRKIGQKIKEFFQKLALEIEQ
0.5 mg AS-61306 $231
SMAP 29, Sheep Myeloid Antimicrobial Peptide 29
RGLRRLGRKIAHGVKKYGPTVLRIIRIAG
1 mg AS-61308 $231
Temporin A, amide
FLPLIGRVLSGIL - NH2
1 mg AS-64831 $83
Temporin L, amide
FVQWFSKFLGRIL - NH2
1 mg AS-64836 $83
  < Back